PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_64405g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 324aa    MW: 36637 Da    PI: 6.1758
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_64405g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.25.2e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT  Ed +l ++v+ +G g+W+  +++ g+ R++k+c++rw++yl
    MA_64405g0010 14 RGAWTSKEDMILSEYVRIHGDGRWRNLPQKAGLMRCGKSCRLRWLNYL 61
                     89********************************************97 PP

2Myb_DNA-binding51.72e-1667110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ +++E+el+++++++lG++ W++Ia +++ gRt++++k++w++
    MA_64405g0010  67 RGNISPDEEELIIRLHRLLGNR-WSLIAGRLP-GRTDNEIKNYWNT 110
                      7899******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.31961IPR017930Myb domain
SuperFamilySSF466891.34E-2712108IPR009057Homeodomain-like
SMARTSM007171.3E-101363IPR001005SANT/Myb domain
PfamPF002491.7E-131461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-221568IPR009057Homeodomain-like
CDDcd001673.94E-91661No hitNo description
PROSITE profilePS5129426.01762116IPR017930Myb domain
SMARTSM007176.8E-1666114IPR001005SANT/Myb domain
PfamPF002499.0E-1567110IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.3E-2569115IPR009057Homeodomain-like
CDDcd001679.11E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MGRSPCCSKE GLNRGAWTSK EDMILSEYVR IHGDGRWRNL PQKAGLMRCG KSCRLRWLNY  60
LRPDIKRGNI SPDEEELIIR LHRLLGNRWS LIAGRLPGRT DNEIKNYWNT RLNKKRLSMT  120
QSQSQHNSRK NPVFETIPVR IKTAVRHPEI ERLKGSNGYG CTYLSSAFKS CNVEETTNSS  180
MSCGDLLMND SIIVDDSHNK AFAAADDLVE TEARNCTFSM SSLADERSPH SDYFAGLPES  240
LLSLNKLFSP DCNMLSSPSD SGSEEFGREP TTLAAETNEF EVACFDQSNV QCGNSFTVDD  300
NQGMEDFFNN TQQLDWIHEL GLQK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-241211525127MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1122550.0BT112255.1 Picea glauca clone GQ03312_J15 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLB8LMJ61e-138B8LMJ6_PICSI; Putative uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22640.11e-53myb domain protein 3